SCOPe 2.08: Domain d6yac2_: 6yac 2:

Lineage for d6yac2_ (6yac 2:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.0: automated matches [276197] (1 protein)
   not a true family

6. Protein automated matches [276200] (4 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)

8. Domain d6yac2_: 6yac 2: [393650]
   Other proteins in same PDB: d6yaca_, d6yacb_, d6yacc_, d6yacd_, d6yace1, d6yace2, d6yacf_, d6yacj_, d6yacl_, d6yacn_
   automated match to d5l8r2_
   complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yac2_

PDB Entry: 6yac, 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex

PDB Compounds: (2:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d6yac2_:

Sequence; same for both SEQRES and ATOM records:

>d6yac2_ f.43.1.0 (2:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tvaepdrplwfpgstpppwldgslpgdfgfdplglgsdpeslrwnvqaelvhsrwamlga
agifipefltklgilntpswytageqeyftdtttlfivelvfigwaegrrwadilnpgcv
ntdpifpnnkltgtdvgypgglwfdplgwgsaspqklkelrtkeikngrlamlavmgawf
qhiytgtgpidnlfahladpghatifaa

Timeline for d6yac2_:

• d6yac2_ first appeared in SCOPe 2.07