SCOPe 2.08: Domain d6yacd_: 6yac D:

Lineage for d6yacd_ (6yac D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
   beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail

4. Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family)
   automatically mapped to Pfam PF02531

5. Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)

6. Protein automated matches [236562] (8 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276208] (9 PDB entries)

8. Domain d6yacd_: 6yac D: [393614]
   Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacc_, d6yace1, d6yace2, d6yacf_, d6yacj_, d6yacl_, d6yacn_
   automated match to d5l8rd_
   complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yacd_

PDB Entry: 6yac, 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex

PDB Compounds: (D:) PsaD

SCOPe Domain Sequences for d6yacd_:

Sequence; same for both SEQRES and ATOM records:

>d6yacd_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gftppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpn
llklarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvn
frsigknvspievkftgkqpydl

Timeline for d6yacd_:

• d6yacd_ first appeared in SCOPe 2.07