Lineage for d2gk1j1 (2gk1 J:167-528)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418522Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 protein domains)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2418529Protein beta-hexosaminidase A [159387] (1 species)
  7. 2418530Species Human (Homo sapiens) [TaxId:9606] [159388] (2 PDB entries)
    Uniprot P06865 167-528
  8. 2418536Domain d2gk1j1: 2gk1 J:167-528 [343671]
    Other proteins in same PDB: d2gk1.1, d2gk1.2, d2gk1.3, d2gk1.4, d2gk1.5, d2gk1.6, d2gk1.7, d2gk1.8, d2gk1.9, d2gk1.a, d2gk1.b, d2gk1.c
    automatically matched to 2GJX A:167-528
    complexed with bma, nag, ngt

Details for d2gk1j1

PDB Entry: 2gk1 (more details), 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa
PDB Compounds: (J:) Beta-hexosaminidase subunit alpha

SCOPe Domain Sequences for d2gk1j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gk1j1 c.1.8.6 (J:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
fphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesftfpelmrkgs
ynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltpcysgsepsgt
fgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiqdfmrkkgfge
dfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredipvnymkelel
vtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalviggeacmwgeyvdn
tnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqplnvgfceqef
eq

SCOPe Domain Coordinates for d2gk1j1:

Click to download the PDB-style file with coordinates for d2gk1j1.
(The format of our PDB-style files is described here.)

Timeline for d2gk1j1: