Lineage for d2gk1.a (2gk1 O:200-300,P:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831967Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2831984Protein beta-hexosaminidase B [89486] (1 species)
  7. 2831985Species Human (Homo sapiens) [TaxId:9606] [89487] (6 PDB entries)
  8. 2832003Domain d2gk1.a: 2gk1 O:200-300,P: [343667]
    Other proteins in same PDB: d2gk1.1, d2gk1.2, d2gk1.3, d2gk1.4, d2gk1.5, d2gk1.6, d2gk1.7, d2gk1.8, d2gk1i1, d2gk1j1, d2gk1k1, d2gk1l1
    automatically matched to d1o7aa1
    complexed with ngt

Details for d2gk1.a

PDB Entry: 2gk1 (more details), 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa
PDB Compounds: (O:) Beta-hexosaminidase subunit beta chain B, (P:) Beta-hexosaminidase subunit beta chain A

SCOPe Domain Sequences for d2gk1.a:

Sequence; same for both SEQRES and ATOM records: (download)

>g2gk1.a c.1.8.6 (O:200-300,P:) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkXdsfgpinptlnttysflt
tffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtdfkklesfyiqkvldi
iatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtasgfpvilsapwyldli
sygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnltprlwprasavgerlw
sskdvrdmddaydrltrhrcrmvergiaaqplyagycn

SCOPe Domain Coordinates for d2gk1.a:

Click to download the PDB-style file with coordinates for d2gk1.a.
(The format of our PDB-style files is described here.)

Timeline for d2gk1.a:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gk1.6
View in 3D
Domains from other chains:
(mouse over for more information)
d2gk1.1, d2gk1.1, d2gk1.1, d2gk1.1, d2gk1.2, d2gk1.2, d2gk1.2, d2gk1.2, d2gk1.3, d2gk1.3, d2gk1.3, d2gk1.3, d2gk1.4, d2gk1.4, d2gk1.4, d2gk1.4, d2gk1.5, d2gk1.5, d2gk1.5, d2gk1.5, d2gk1.6, d2gk1.6, d2gk1.6, d2gk1.7, d2gk1.7, d2gk1.7, d2gk1.7, d2gk1.8, d2gk1.8, d2gk1.8, d2gk1.8, d2gk1.9, d2gk1.9, d2gk1.9, d2gk1.9, d2gk1.b, d2gk1.b, d2gk1.b, d2gk1.b, d2gk1.c, d2gk1.c, d2gk1.c, d2gk1.c, d2gk1i1, d2gk1i1, d2gk1j1, d2gk1j1, d2gk1k1, d2gk1k1, d2gk1l1, d2gk1l1