SCOPe 2.08: Domain d2gk1.8: 2gk1 H:,S:122-199

Lineage for d2gk1.8 (2gk1 H:,S:122-199)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheet
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
contains similar fold but lacks its catalytic centre
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
family GH20
Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)

Domain d2gk1.8: 2gk1 H:,S:122-199 [343665]
Other proteins in same PDB: d2gk1.1, d2gk1.2, d2gk1.3, d2gk1.4, d2gk1.9, d2gk1.a, d2gk1.b, d2gk1.c, d2gk1i1, d2gk1j1, d2gk1k1, d2gk1l1
automatically matched to d1o7aa2
complexed with ngt

Details for d2gk1.8

PDB Entry: 2gk1 (more details), 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa

PDB Compounds: (H:) Beta-hexosaminidase subunit beta, (S:) Beta-hexosaminidase subunit beta chain B

SCOPe Domain Sequences for d2gk1.8:

Sequence; same for both SEQRES and ATOM records: (download)

>g2gk1.8 d.92.2.1 (H:,S:122-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgXtqvqq
llvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygt
ftinestiidspr

SCOPe Domain Coordinates for d2gk1.8:

Click to download the PDB-style file with coordinates for d2gk1.8.
(The format of our PDB-style files is described here.)

Timeline for d2gk1.8: