SCOPe 2.08: Domain d2gk1k1: 2gk1 K:167-528

Lineage for d2gk1k1 (2gk1 K:167-528)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
   Glycosyl hydrolase family 20, GH20
   automatically mapped to Pfam PF00728

6. Protein beta-hexosaminidase A [159387] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159388] (2 PDB entries)
   Uniprot P06865 167-528

8. Domain d2gk1k1: 2gk1 K:167-528 [343672]
   Other proteins in same PDB: d2gk1.1, d2gk1.2, d2gk1.3, d2gk1.4, d2gk1.5, d2gk1.6, d2gk1.7, d2gk1.8, d2gk1.9, d2gk1.a, d2gk1.b, d2gk1.c
   automatically matched to 2GJX A:167-528
   complexed with ngt

Details for d2gk1k1

PDB Entry: 2gk1, 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa

PDB Compounds: (K:) Beta-hexosaminidase subunit alpha

SCOPe Domain Sequences for d2gk1k1:

Sequence; same for both SEQRES and ATOM records:

>d2gk1k1 c.1.8.6 (K:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
fphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesftfpelmrkgs
ynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltpcysgsepsgt
fgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiqdfmrkkgfge
dfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredipvnymkelel
vtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalviggeacmwgeyvdn
tnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqplnvgfceqef
eq

Timeline for d2gk1k1:

• d2gk1k1 first appeared in SCOPe 2.07