Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins) Glycosyl hydrolase family 20, GH20 automatically mapped to Pfam PF00728 |
Protein beta-hexosaminidase A [159387] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159388] (2 PDB entries) Uniprot P06865 167-528 |
Domain d2gk1k1: 2gk1 K:167-528 [343672] Other proteins in same PDB: d2gk1.1, d2gk1.2, d2gk1.3, d2gk1.4, d2gk1.5, d2gk1.6, d2gk1.7, d2gk1.8, d2gk1.9, d2gk1.a, d2gk1.b, d2gk1.c automatically matched to 2GJX A:167-528 complexed with ngt |
PDB Entry: 2gk1 (more details), 3.25 Å
SCOPe Domain Sequences for d2gk1k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gk1k1 c.1.8.6 (K:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} fphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesftfpelmrkgs ynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltpcysgsepsgt fgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiqdfmrkkgfge dfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredipvnymkelel vtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalviggeacmwgeyvdn tnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqplnvgfceqef eq
Timeline for d2gk1k1:
View in 3D Domains from other chains: (mouse over for more information) d2gk1.1, d2gk1.1, d2gk1.2, d2gk1.2, d2gk1.3, d2gk1.4, d2gk1.4, d2gk1.5, d2gk1.5, d2gk1.6, d2gk1.6, d2gk1.7, d2gk1.7, d2gk1.8, d2gk1.8, d2gk1.9, d2gk1.9, d2gk1.a, d2gk1.a, d2gk1.b, d2gk1.b, d2gk1.c, d2gk1.c, d2gk1i1, d2gk1j1, d2gk1l1 |