SCOPe 2.08: Domain d2gk1.1: 2gk1 A:,I:89-166

Lineage for d2gk1.1 (2gk1 A:,I:89-166)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
   family GH20

6. Protein beta-hexosaminidase A [160560] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160561] (2 PDB entries)
   Uniprot P06865 23-166

8. Domain d2gk1.1: 2gk1 A:,I:89-166 [343658]
   Other proteins in same PDB: d2gk1.5, d2gk1.6, d2gk1.7, d2gk1.8, d2gk1.9, d2gk1.a, d2gk1.b, d2gk1.c, d2gk1i1, d2gk1j1, d2gk1k1, d2gk1l1
   automatically matched to 2GJX A:23-166
   complexed with ngt

Details for d2gk1.1

PDB Entry: 2gk1, 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa

PDB Compounds: (A:) Beta-hexosaminidase subunit alpha, (I:) Beta-hexosaminidase subunit alpha

SCOPe Domain Sequences for d2gk1.1:

Sequence; same for both SEQRES and ATOM records:

>g2gk1.1 d.92.2.1 (A:,I:89-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgXtleknvl
vvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtff
inkteiedfpr

Timeline for d2gk1.1:

• d2gk1.1 first appeared in SCOPe 2.07