SCOPe 2.08: Domain d2gk1.c: 2gk1 S:200-300,T:

Lineage for d2gk1.c (2gk1 S:200-300,T:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
   Glycosyl hydrolase family 20, GH20
   automatically mapped to Pfam PF00728

6. Protein beta-hexosaminidase B [89486] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89487] (6 PDB entries)

8. Domain d2gk1.c: 2gk1 S:200-300,T: [343669]
   Other proteins in same PDB: d2gk1.1, d2gk1.2, d2gk1.3, d2gk1.4, d2gk1.5, d2gk1.6, d2gk1.7, d2gk1.8, d2gk1i1, d2gk1j1, d2gk1k1, d2gk1l1
   automatically matched to d1o7aa1
   complexed with ngt

Details for d2gk1.c

PDB Entry: 2gk1, 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa

PDB Compounds: (S:) Beta-hexosaminidase subunit beta chain B, (T:) Beta-hexosaminidase subunit beta chain A

SCOPe Domain Sequences for d2gk1.c:

Sequence; same for both SEQRES and ATOM records:

>g2gk1.c c.1.8.6 (S:200-300,T:) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkXdsfgpinptlnttysflt
tffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtdfkklesfyiqkvldi
iatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtasgfpvilsapwyldli
sygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnltprlwprasavgerlw
sskdvrdmddaydrltrhrcrmvergiaaqplyagycn

Timeline for d2gk1.c:

• d2gk1.c first appeared in SCOPe 2.07