Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) automatically mapped to Pfam PF01788 |
Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
Protein Photosystem II reaction center protein J, PsbJ [161023] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161024] (3 PDB entries) Uniprot P59087 7-40 |
Domain d5h2fj_: 5h2f J: [338559] Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fk_, d5h2fl_, d5h2ft_, d5h2fv_, d5h2fx_, d5h2fz_ automated match to d2axtj1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant |
PDB Entry: 5h2f (more details), 2.2 Å
SCOPe Domain Sequences for d5h2fj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h2fj_ f.23.32.1 (J:) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus elongatus [TaxId: 146786]} ggriplwivatvagmgvivivglffygayaglgssl
Timeline for d5h2fj_: