Lineage for d5h2fc_ (5h2f C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256467Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2256468Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2256469Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 2256485Protein automated matches [191285] (3 species)
    not a true protein
  7. 2256493Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (15 PDB entries)
  8. 2256510Domain d5h2fc_: 5h2f C: [338585]
    Other proteins in same PDB: d5h2fa_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2ft_, d5h2fv_, d5h2fx_, d5h2fz_
    automated match to d5b66c_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fc_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (C:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d5h2fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fc_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy
eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee
yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp
tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr
afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq
klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn
diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl
whagraraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d5h2fc_:

Click to download the PDB-style file with coordinates for d5h2fc_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fc_: