SCOPe 2.06: Domain d5h2ff_: 5h2f F:

Lineage for d5h2ff_ (5h2f F:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (4 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [326602] (5 PDB entries)

8. Domain d5h2ff_: 5h2f F: [338488]
   Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2ft_, d5h2fv_, d5h2fx_, d5h2fz_
   automated match to d4ub8f_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2ff_

PDB Entry: 5h2f, 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5h2ff_:

Sequence; same for both SEQRES and ATOM records:

>d5h2ff_ f.23.38.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d5h2ff_:

• d5h2ff_ is new in SCOPe 2.06-stable
  
• d5h2ff_ appears in SCOPe 2.07
  
• d5h2ff_ appears in the current release, SCOPe 2.08