Lineage for d5h2fe_ (5h2f E:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254945Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2254946Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2254947Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)
  7. 2254951Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (10 PDB entries)
  8. 2254960Domain d5h2fe_: 5h2f E: [338524]
    Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2ft_, d5h2fv_, d5h2fx_, d5h2fz_
    automated match to d3wu2e_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fe_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d5h2fe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fe_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}
tgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsip
lvtdrfeakqqvetfleql

SCOPe Domain Coordinates for d5h2fe_:

Click to download the PDB-style file with coordinates for d5h2fe_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fe_: