Lineage for d5h2fl_ (5h2f L:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254762Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 2254763Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 2254783Protein automated matches [191003] (2 species)
    not a true protein
  7. 2254784Species Thermosynechococcus elongatus [TaxId:197221] [338576] (1 PDB entry)
  8. 2254785Domain d5h2fl_: 5h2f L: [338577]
    Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2ft_, d5h2fv_, d5h2fx_, d5h2fz_
    automated match to d2axtl1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fl_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5h2fl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fl_ f.23.31.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
pnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d5h2fl_:

Click to download the PDB-style file with coordinates for d5h2fl_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fl_: