Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) automatically mapped to Pfam PF02419 |
Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
Protein automated matches [191003] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [338576] (1 PDB entry) |
Domain d5h2fl_: 5h2f L: [338577] Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2ft_, d5h2fv_, d5h2fx_, d5h2fz_ automated match to d2axtl1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant |
PDB Entry: 5h2f (more details), 2.2 Å
SCOPe Domain Sequences for d5h2fl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h2fl_ f.23.31.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} pnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d5h2fl_: