Lineage for d5h2fz_ (5h2f Z:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252855Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2253087Superfamily f.17.5: PsbZ-like [161055] (1 family) (S)
    automatically mapped to Pfam PF01737
  5. 2253088Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 2253089Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 2253090Species Thermosynechococcus elongatus [TaxId:146786] [161058] (8 PDB entries)
    Uniprot Q8DHJ2 1-62
  8. 2253091Domain d5h2fz_: 5h2f Z: [338490]
    Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2ft_, d5h2fv_, d5h2fx_
    automated match to d2axtz1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fz_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5h2fz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d5h2fz_:

Click to download the PDB-style file with coordinates for d5h2fz_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fz_: