Lineage for d2axtz1 (2axt Z:1-62)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252855Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2253087Superfamily f.17.5: PsbZ-like [161055] (1 family) (S)
    automatically mapped to Pfam PF01737
  5. 2253088Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 2253089Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 2253090Species Thermosynechococcus elongatus [TaxId:146786] [161058] (8 PDB entries)
    Uniprot Q8DHJ2 1-62
  8. 2253094Domain d2axtz1: 2axt Z:1-62 [144941]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtz1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (Z:) Photosystem II reaction center Z protein

SCOPe Domain Sequences for d2axtz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtz1 f.17.5.1 (Z:1-62) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d2axtz1:

Click to download the PDB-style file with coordinates for d2axtz1.
(The format of our PDB-style files is described here.)

Timeline for d2axtz1: