Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.5: PsbZ-like [161055] (1 family) automatically mapped to Pfam PF01737 |
Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161058] (8 PDB entries) Uniprot Q8DHJ2 1-62 |
Domain d2axtz1: 2axt Z:1-62 [144941] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_ complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axtz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtz1 f.17.5.1 (Z:1-62) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]} mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff vv
Timeline for d2axtz1: