Domain d2axtz1: 2axt Z:1-62

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d2axtz1 (2axt Z:1-62)

Root: SCOP 1.75B
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
two antiparallel transmembrane helices
Superfamily f.17.5: PsbZ-like [161055] (1 family)
Family f.17.5.1: PsbZ-like [161056] (1 protein)
Pfam PF01737; Ycf9
Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
Species Thermosynechococcus elongatus [TaxId:146786] [161058] (3 PDB entries)
Uniprot Q8DHJ2 1-62

Domain d2axtz1: 2axt Z:1-62 [144941]
Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1
complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

PDB Entry: 2axt (more details)
PDB Description: crystal structure of photosystem ii from thermosynechococcus
PDB Compounds: (Z:) Photosystem II reaction center Z protein

SCOP Domain Sequences for d2axtz1:
Sequence; same for both SEQRES and ATOM records: (download)

>d2axtz1 f.17.5.1 (Z:1-62) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]} mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff vv

SCOP Domain Coordinates for d2axtz1:

Click to download the PDB-style file with coordinates for d2axtz1.
(The format of our PDB-style files is described here.)

Timeline for d2axtz1:
d2axtz1 appears in SCOP 1.75A

d2axtz1
(click for larger image)

d2axtz1 in context of chain

d2axtz1 in context of PDB
Domains from other chains:
d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1