SCOPe 2.08: Domain d5h2fe_: 5h2f E:

Lineage for d5h2fe_ (5h2f E:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161048] (7 PDB entries)
   Uniprot Q8DIP0 3-84

8. Domain d5h2fe_: 5h2f E: [338524]
   Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fv_, d5h2fx_, d5h2fz_
   automated match to d3wu2e_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d5h2fe_

PDB Entry: 5h2f, 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii

PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d5h2fe_:

Sequence; same for both SEQRES and ATOM records:

>d5h2fe_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus elongatus [TaxId: 146786]}
tgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsip
lvtdrfeakqqvetfleql

Timeline for d5h2fe_:

• d5h2fe_ first appeared in SCOPe 2.06
  
• d5h2fe_ appears in SCOPe 2.07