| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
| Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
| Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161048] (7 PDB entries) Uniprot Q8DIP0 3-84 |
| Domain d5h2fe_: 5h2f E: [338524] Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fv_, d5h2fx_, d5h2fz_ automated match to d3wu2e_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5h2f (more details), 2.2 Å
SCOPe Domain Sequences for d5h2fe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h2fe_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus elongatus [TaxId: 146786]}
tgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsip
lvtdrfeakqqvetfleql
Timeline for d5h2fe_: