![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
![]() | Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
![]() | Protein automated matches [191000] (6 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [326602] (6 PDB entries) |
![]() | Domain d5h2ff_: 5h2f F: [338488] Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fv_, d5h2fx_, d5h2fz_ automated match to d4ub8f_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant |
PDB Entry: 5h2f (more details), 2.2 Å
SCOPe Domain Sequences for d5h2ff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h2ff_ f.23.38.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} ypiftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d5h2ff_: