Lineage for d5h2fj_ (5h2f J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026440Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 3026441Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 3026442Protein Photosystem II reaction center protein J, PsbJ [161023] (2 species)
  7. 3026443Species Thermosynechococcus elongatus [TaxId:146786] [161024] (3 PDB entries)
    Uniprot P59087 7-40
  8. 3026444Domain d5h2fj_: 5h2f J: [338559]
    Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fv_, d5h2fx_, d5h2fz_
    automated match to d2axtj1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fj_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5h2fj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fj_ f.23.32.1 (J:) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus elongatus [TaxId: 146786]}
ggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5h2fj_:

Click to download the PDB-style file with coordinates for d5h2fj_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fj_: