|  | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) | 
|  | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest | 
|  | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)  | 
|  | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) | 
|  | Protein automated matches [227071] (7 species) not a true protein | 
|  | Species Chicken (Gallus gallus) [TaxId:9031] [278823] (2 PDB entries) | 
|  | Domain d5fnvc2: 5fnv C:246-439 [317485] Other proteins in same PDB: d5fnva1, d5fnvb1, d5fnvb2, d5fnvc1, d5fnvd1, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2, d5fnvf3 automated match to d4i50a2 complexed with acp, ca, gdp, gtp, mes, mg, x3h | 
PDB Entry: 5fnv (more details), 2.61 Å
SCOPe Domain Sequences for d5fnvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fnvc2 d.79.2.1 (C:246-439) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds
Timeline for d5fnvc2: