Lineage for d5fnvc2 (5fnv C:246-439)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2565858Species Chicken (Gallus gallus) [TaxId:9031] [278823] (2 PDB entries)
  8. 2565862Domain d5fnvc2: 5fnv C:246-439 [317485]
    Other proteins in same PDB: d5fnva1, d5fnvb1, d5fnvb2, d5fnvc1, d5fnvd1, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2, d5fnvf3
    automated match to d4i50a2
    complexed with acp, ca, gdp, gtp, mes, mg, x3h

Details for d5fnvc2

PDB Entry: 5fnv (more details), 2.61 Å

PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5fnvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fnvc2 d.79.2.1 (C:246-439) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d5fnvc2:

Click to download the PDB-style file with coordinates for d5fnvc2.
(The format of our PDB-style files is described here.)

Timeline for d5fnvc2: