Lineage for d5fnvf3 (5fnv F:77-378)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978888Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2978889Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)
  7. 2979054Species Pig (Sus scrofa) [TaxId:9823] [346383] (1 PDB entry)
  8. 2979055Domain d5fnvf3: 5fnv F:77-378 [344215]
    Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb1, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd1, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2
    complexed with acp, ca, gdp, gtp, mes, mg, x3h

Details for d5fnvf3

PDB Entry: 5fnv (more details), 2.61 Å

PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5fnvf3:

Sequence, based on SEQRES records: (download)

>d5fnvf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5fnvf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
lvkliktspelsesctwfpesyviyptgnvwiakgilisseahviqkylekplllepghr
kfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqknygryeegne
mffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmv
deelkvwlievngapacaqklyaelcqgivdvaissvfplsifikl

SCOPe Domain Coordinates for d5fnvf3:

Click to download the PDB-style file with coordinates for d5fnvf3.
(The format of our PDB-style files is described here.)

Timeline for d5fnvf3: