![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
![]() | Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [346383] (1 PDB entry) |
![]() | Domain d5fnvf3: 5fnv F:77-378 [344215] Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb1, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd1, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2 complexed with acp, ca, gdp, gtp, mes, mg, x3h |
PDB Entry: 5fnv (more details), 2.61 Å
SCOPe Domain Sequences for d5fnvf3:
Sequence, based on SEQRES records: (download)
>d5fnvf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5fnvf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} lvkliktspelsesctwfpesyviyptgnvwiakgilisseahviqkylekplllepghr kfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqknygryeegne mffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmv deelkvwlievngapacaqklyaelcqgivdvaissvfplsifikl
Timeline for d5fnvf3: