![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
![]() | Protein automated matches [226903] (40 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [317436] (1 PDB entry) |
![]() | Domain d5fnvf1: 5fnv F:1-76 [317437] Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb1, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd1, d5fnvd2, d5fnve_, d5fnvf2, d5fnvf3 automated match to d3tiia1 complexed with acp, ca, gdp, gtp, mes, mg, x3h |
PDB Entry: 5fnv (more details), 2.61 Å
SCOPe Domain Sequences for d5fnvf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fnvf1 c.30.1.0 (F:1-76) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq lvnyyrgadklcrkas
Timeline for d5fnvf1: