![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
![]() | Family a.137.10.1: Stathmin [101495] (2 proteins) |
![]() | Protein automated matches [317456] (2 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [317457] (3 PDB entries) |
![]() | Domain d5fnve_: 5fnv E: [317458] Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb1, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd1, d5fnvd2, d5fnvf1, d5fnvf2, d5fnvf3 automated match to d4i55e_ complexed with acp, ca, gdp, gtp, mes, mg, x3h |
PDB Entry: 5fnv (more details), 2.61 Å
SCOPe Domain Sequences for d5fnve_:
Sequence, based on SEQRES records: (download)
>d5fnve_ a.137.10.1 (E:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelk
>d5fnve_ a.137.10.1 (E:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
Timeline for d5fnve_: