SCOPe 2.08: Domain d5fnvb1: 5fnv B:2-243

Lineage for d5fnvb1 (5fnv B:2-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Tubulin beta-subunit [52496] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [63990] (6 PDB entries)
   Uniprot P02550 ! Uniprot P02554

8. Domain d5fnvb1: 5fnv B:2-243 [317449]
   Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2, d5fnvf3
   automated match to d1sa0b1
   complexed with acp, ca, gdp, gtp, mes, mg, x3h

Details for d5fnvb1

PDB Entry: 5fnv, 2.61 Å

PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5fnvb1:

Sequence, based on SEQRES records:

>d5fnvb1 c.32.1.1 (B:2-243) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Sequence, based on observed residues (ATOM records):

>d5fnvb1 c.32.1.1 (B:2-243) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyynekyvprail
vdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrkese
scdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvvepyna
tlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclrfp

Timeline for d5fnvb1:

• d5fnvb1 first appeared in SCOPe 2.06
  
• d5fnvb1 appears in SCOPe 2.07