![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein Tubulin beta-subunit [52496] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [63990] (7 PDB entries) Uniprot P02550 ! Uniprot P02554 |
![]() | Domain d5fnvb1: 5fnv B:2-243 [317449] Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2, d5fnvf3 automated match to d1sa0b1 complexed with acp, ca, gdp, gtp, mes, mg, x3h |
PDB Entry: 5fnv (more details), 2.61 Å
SCOPe Domain Sequences for d5fnvb1:
Sequence, based on SEQRES records: (download)
>d5fnvb1 c.32.1.1 (B:2-243) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr fp
>d5fnvb1 c.32.1.1 (B:2-243) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyynekyvprail vdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrkese scdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvvepyna tlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclrfp
Timeline for d5fnvb1: