Lineage for d5fnvb1 (5fnv B:2-243)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471520Protein Tubulin beta-subunit [52496] (2 species)
  7. 2471521Species Cow (Bos taurus) [TaxId:9913] [63990] (7 PDB entries)
    Uniprot P02550 ! Uniprot P02554
  8. 2471524Domain d5fnvb1: 5fnv B:2-243 [317449]
    Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2, d5fnvf3
    automated match to d1sa0b1
    complexed with acp, ca, gdp, gtp, mes, mg, x3h

Details for d5fnvb1

PDB Entry: 5fnv (more details), 2.61 Å

PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5fnvb1:

Sequence, based on SEQRES records: (download)

>d5fnvb1 c.32.1.1 (B:2-243) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Sequence, based on observed residues (ATOM records): (download)

>d5fnvb1 c.32.1.1 (B:2-243) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyynekyvprail
vdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrkese
scdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvvepyna
tlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclrfp

SCOPe Domain Coordinates for d5fnvb1:

Click to download the PDB-style file with coordinates for d5fnvb1.
(The format of our PDB-style files is described here.)

Timeline for d5fnvb1: