Lineage for d5fnvc1 (5fnv C:1-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445284Species Chicken (Gallus gallus) [TaxId:9031] [278810] (2 PDB entries)
  8. 2445288Domain d5fnvc1: 5fnv C:1-245 [317484]
    Other proteins in same PDB: d5fnva2, d5fnvb1, d5fnvb2, d5fnvc2, d5fnvd1, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2, d5fnvf3
    automated match to d4ihja1
    complexed with acp, ca, gdp, gtp, mes, mg, x3h

Details for d5fnvc1

PDB Entry: 5fnv (more details), 2.61 Å

PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5fnvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fnvc1 c.32.1.1 (C:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5fnvc1:

Click to download the PDB-style file with coordinates for d5fnvc1.
(The format of our PDB-style files is described here.)

Timeline for d5fnvc1: