Lineage for d5fnve_ (5fnv E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346952Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2346953Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2347150Protein automated matches [317456] (2 species)
    not a true protein
  7. 2347151Species Pig (Sus scrofa) [TaxId:9823] [317457] (3 PDB entries)
  8. 2347154Domain d5fnve_: 5fnv E: [317458]
    Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb1, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd1, d5fnvd2, d5fnvf1, d5fnvf2, d5fnvf3
    automated match to d4i55e_
    complexed with acp, ca, gdp, gtp, mes, mg, x3h

Details for d5fnve_

PDB Entry: 5fnv (more details), 2.61 Å

PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5fnve_:

Sequence, based on SEQRES records: (download)

>d5fnve_ a.137.10.1 (E:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelk

Sequence, based on observed residues (ATOM records): (download)

>d5fnve_ a.137.10.1 (E:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk

SCOPe Domain Coordinates for d5fnve_:

Click to download the PDB-style file with coordinates for d5fnve_.
(The format of our PDB-style files is described here.)

Timeline for d5fnve_: