Lineage for d5fnvd1 (5fnv D:2-243)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein Tubulin beta-subunit [52496] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [63990] (7 PDB entries)
Uniprot P02550 ! Uniprot P02554
Domain d5fnvd1: 5fnv D:2-243 [317452]
Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2, d5fnvf3
automated match to d1sa0b1
complexed with acp, ca, gdp, gtp, mes, mg, x3h
Details for d5fnvd1
PDB Entry: 5fnv (more details), 2.61 Å
PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone
PDB Compounds: (D:) Tubulin beta chainSCOPe Domain Sequences for d5fnvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fnvd1 c.32.1.1 (D:2-243) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp
SCOPe Domain Coordinates for d5fnvd1:
Click to download the PDB-style file with coordinates for d5fnvd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5fnvd1:
View in 3D
