SCOPe 2.07: Domain d5fnvf1: 5fnv F:1-76

Lineage for d5fnvf1 (5fnv F:1-76)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (39 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [317436] (1 PDB entry)

8. Domain d5fnvf1: 5fnv F:1-76 [317437]
   Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb1, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd1, d5fnvd2, d5fnve_, d5fnvf2, d5fnvf3
   automated match to d3tiia1
   complexed with acp, ca, gdp, gtp, mes, mg, x3h

Details for d5fnvf1

PDB Entry: 5fnv, 2.61 Å

PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone

PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5fnvf1:

Sequence; same for both SEQRES and ATOM records:

>d5fnvf1 c.30.1.0 (F:1-76) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d5fnvf1:

• d5fnvf1 first appeared in SCOPe 2.06
  
• d5fnvf1 appears in the current release, SCOPe 2.08