Lineage for d5fnvf1 (5fnv F:1-76)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470712Species Pig (Sus scrofa) [TaxId:9823] [317436] (1 PDB entry)
  8. 2470713Domain d5fnvf1: 5fnv F:1-76 [317437]
    Other proteins in same PDB: d5fnva1, d5fnva2, d5fnvb1, d5fnvb2, d5fnvc1, d5fnvc2, d5fnvd1, d5fnvd2, d5fnve_, d5fnvf2, d5fnvf3
    automated match to d3tiia1
    complexed with acp, ca, gdp, gtp, mes, mg, x3h

Details for d5fnvf1

PDB Entry: 5fnv (more details), 2.61 Å

PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5fnvf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fnvf1 c.30.1.0 (F:1-76) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5fnvf1:

Click to download the PDB-style file with coordinates for d5fnvf1.
(The format of our PDB-style files is described here.)

Timeline for d5fnvf1: