Lineage for d5fnvc1 (5fnv C:1-245)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein automated matches [226837] (10 species)
not a true protein
Species Chicken (Gallus gallus) [TaxId:9031] [278810] (20 PDB entries) 
Domain d5fnvc1: 5fnv C:1-245 [317484]
Other proteins in same PDB: d5fnva2, d5fnvb1, d5fnvb2, d5fnvc2, d5fnvd1, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2, d5fnvf3
automated match to d4ihja1
complexed with acp, ca, gdp, gtp, mes, mg, x3h
Details for d5fnvc1
PDB Entry: 5fnv (more details), 2.61 Å
PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone
PDB Compounds: (C:) Tubulin alpha-1B chainSCOPe Domain Sequences for d5fnvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fnvc1 c.32.1.1 (C:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd
SCOPe Domain Coordinates for d5fnvc1:
Click to download the PDB-style file with coordinates for d5fnvc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5fnvc1:
View in 3D
