Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Polymyxin resistance protein ArnA (PrmI) [117419] (1 species) evolved new activities: UDP-glucuronic acid decarboxylase, UDP-4-amino-4-deoxy-L-arabinose formyltransferase |
Species Escherichia coli [TaxId:562] [117420] (8 PDB entries) Uniprot P77398 |
Domain d4wkgb3: 4wkg B:314-656 [262113] Other proteins in same PDB: d4wkga1, d4wkga2, d4wkgb1, d4wkgb2, d4wkgc1, d4wkgc2, d4wkgd1, d4wkgd2, d4wkge1, d4wkge2, d4wkgf1, d4wkgf2 automated match to d1z7ea2 complexed with act, dtt has additional subdomain(s) that are not in the common domain |
PDB Entry: 4wkg (more details), 2.7 Å
SCOPe Domain Sequences for d4wkgb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wkgb3 c.2.1.2 (B:314-656) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} rrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihs ewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpsts evygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnw mgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriien agnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgy qdvehrkpsirnahrcldwepkidmqetidetldfflrtvdlt
Timeline for d4wkgb3: