Lineage for d4wkge1 (4wkg E:1-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892512Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2892596Protein Polymyxin resistance protein ArnA, N-terminal domain [142569] (1 species)
  7. 2892597Species Escherichia coli [TaxId:562] [142570] (4 PDB entries)
    Uniprot P77398 1-200! Uniprot P77398 1-203
  8. 2892611Domain d4wkge1: 4wkg E:1-200 [262096]
    Other proteins in same PDB: d4wkga2, d4wkga3, d4wkgb2, d4wkgb3, d4wkgc2, d4wkgc3, d4wkgd2, d4wkge2, d4wkgf2, d4wkgf3
    automated match to d1z7ea3
    complexed with act, dtt

Details for d4wkge1

PDB Entry: 4wkg (more details), 2.7 Å

PDB Description: the crystal structure of apo arna features an unexpected central binding pocket and provides an explanation for enzymatic coop- erativity
PDB Compounds: (E:) Bifunctional polymyxin resistance protein ArnA

SCOPe Domain Sequences for d4wkge1:

Sequence, based on SEQRES records: (download)

>d4wkge1 c.65.1.1 (E:1-200) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
khgnileiaqreneatcfgr

Sequence, based on observed residues (ATOM records): (download)

>d4wkge1 c.65.1.1 (E:1-200) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdnpfygsvarlaaergipvyapdnvnh
plwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvng
etetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgn
ileiaqreneatcfgr

SCOPe Domain Coordinates for d4wkge1:

Click to download the PDB-style file with coordinates for d4wkge1.
(The format of our PDB-style files is described here.)

Timeline for d4wkge1: