Lineage for d4wkgb3 (4wkg B:314-656)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576689Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1577673Protein Polymyxin resistance protein ArnA (PrmI) [117419] (1 species)
    evolved new activities: UDP-glucuronic acid decarboxylase, UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  7. 1577674Species Escherichia coli [TaxId:562] [117420] (8 PDB entries)
    Uniprot P77398
  8. 1577682Domain d4wkgb3: 4wkg B:314-656 [262113]
    Other proteins in same PDB: d4wkga1, d4wkga2, d4wkgb1, d4wkgb2, d4wkgc1, d4wkgc2, d4wkgd1, d4wkgd2, d4wkge1, d4wkge2, d4wkgf1, d4wkgf2
    automated match to d1z7ea2
    complexed with act, dtt

Details for d4wkgb3

PDB Entry: 4wkg (more details), 2.7 Å

PDB Description: the crystal structure of apo arna features an unexpected central binding pocket and provides an explanation for enzymatic coop- erativity
PDB Compounds: (B:) Bifunctional polymyxin resistance protein ArnA

SCOPe Domain Sequences for d4wkgb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wkgb3 c.2.1.2 (B:314-656) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}
rrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihs
ewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpsts
evygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnw
mgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriien
agnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgy
qdvehrkpsirnahrcldwepkidmqetidetldfflrtvdlt

SCOPe Domain Coordinates for d4wkgb3:

Click to download the PDB-style file with coordinates for d4wkgb3.
(The format of our PDB-style files is described here.)

Timeline for d4wkgb3: