Class b: All beta proteins [48724] (180 folds) |
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) |
Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins) |
Protein Polymyxin resistance protein ArnA, domain 2 [141381] (1 species) |
Species Escherichia coli [TaxId:562] [141382] (4 PDB entries) Uniprot P77398 201-304! Uniprot P77398 204-304 |
Domain d4wkgc2: 4wkg C:201-304 [262101] Other proteins in same PDB: d4wkga1, d4wkga3, d4wkgb1, d4wkgb3, d4wkgc1, d4wkgc3, d4wkgd1, d4wkge1, d4wkgf1, d4wkgf3 automated match to d1z7ea1 complexed with act, dtt |
PDB Entry: 4wkg (more details), 2.7 Å
SCOPe Domain Sequences for d4wkgc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wkgc2 b.46.1.1 (C:201-304) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]} rtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvi svaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrl
Timeline for d4wkgc2: