SCOPe 2.08: Domain d4wkgc1: 4wkg C:1-200

Lineage for d4wkgc1 (4wkg C:1-200)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (5 proteins)

6. Protein Polymyxin resistance protein ArnA, N-terminal domain [142569] (1 species)

7. Species Escherichia coli [TaxId:562] [142570] (4 PDB entries)
   Uniprot P77398 1-200! Uniprot P77398 1-203

8. Domain d4wkgc1: 4wkg C:1-200 [262095]
   Other proteins in same PDB: d4wkga2, d4wkga3, d4wkgb2, d4wkgb3, d4wkgc2, d4wkgc3, d4wkgd2, d4wkge2, d4wkgf2, d4wkgf3
   automated match to d1z7ea3
   complexed with act, dtt

Details for d4wkgc1

PDB Entry: 4wkg, 2.7 Å

PDB Description: the crystal structure of apo arna features an unexpected central binding pocket and provides an explanation for enzymatic coop- erativity

PDB Compounds: (C:) Bifunctional polymyxin resistance protein ArnA

SCOPe Domain Sequences for d4wkgc1:

Sequence, based on SEQRES records:

>d4wkgc1 c.65.1.1 (C:1-200) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
khgnileiaqreneatcfgr

Sequence, based on observed residues (ATOM records):

>d4wkgc1 c.65.1.1 (C:1-200) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdnpygsvarlaaergipvyapdnvnhp
lwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvnge
tetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgni
leiaqreneatcfgr

Timeline for d4wkgc1:

• d4wkgc1 first appeared in SCOPe 2.04
  
• d4wkgc1 appears in SCOPe 2.07