Lineage for d4jghb_ (4jgh B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932662Species Mouse (Mus musculus) [TaxId:10090] [187278] (3 PDB entries)
  8. 2932666Domain d4jghb_: 4jgh B: [252933]
    Other proteins in same PDB: d4jgha1, d4jgha2, d4jgha3, d4jghc_, d4jghd1, d4jghd2
    automated match to d3zrcg_

Details for d4jghb_

PDB Entry: 4jgh (more details), 3 Å

PDB Description: Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5
PDB Compounds: (B:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4jghb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jghb_ d.15.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppeeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealriepfssppelpdvmk

SCOPe Domain Coordinates for d4jghb_:

Click to download the PDB-style file with coordinates for d4jghb_.
(The format of our PDB-style files is described here.)

Timeline for d4jghb_: