| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein automated matches [190118] (16 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187278] (3 PDB entries) |
| Domain d4jghb_: 4jgh B: [252933] Other proteins in same PDB: d4jgha1, d4jgha2, d4jgha3, d4jghc_, d4jghd1, d4jghd2 automated match to d3zrcg_ |
PDB Entry: 4jgh (more details), 3 Å
SCOPe Domain Sequences for d4jghb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jghb_ d.15.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppeeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealriepfssppelpdvmk
Timeline for d4jghb_: