SCOPe 2.04: Domain d4jghb_: 4jgh B:

Lineage for d4jghb_ (4jgh B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187278] (3 PDB entries)

8. Domain d4jghb_: 4jgh B: [252933]
   Other proteins in same PDB: d4jgha1, d4jgha2, d4jghc_, d4jghd_
   automated match to d3zrcg_

Details for d4jghb_

PDB Entry: 4jgh, 3 Å

PDB Description: Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5

PDB Compounds: (B:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4jghb_:

Sequence; same for both SEQRES and ATOM records:

>d4jghb_ d.15.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppeeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealriepfssppelpdvmk

Timeline for d4jghb_:

• d4jghb_ is new in SCOPe 2.04-stable
  
• d4jghb_ appears in SCOPe 2.05
  
• d4jghb_ appears in the current release, SCOPe 2.07