Lineage for d4jghc_ (4jgh C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647424Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1647551Protein automated matches [232759] (2 species)
    not a true protein
  7. 1647555Species Mouse (Mus musculus) [TaxId:10090] [256331] (1 PDB entry)
  8. 1647556Domain d4jghc_: 4jgh C: [252934]
    Other proteins in same PDB: d4jgha1, d4jgha2, d4jghb_, d4jghd_
    automated match to d4b9kb_

Details for d4jghc_

PDB Entry: 4jgh (more details), 3 Å

PDB Description: Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5
PDB Compounds: (C:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4jghc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jghc_ d.42.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeiplellmaanfldc

SCOPe Domain Coordinates for d4jghc_:

Click to download the PDB-style file with coordinates for d4jghc_.
(The format of our PDB-style files is described here.)

Timeline for d4jghc_: