Lineage for d4jghd1 (4jgh D:10-386)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007926Superfamily a.118.17: Cullin repeat-like [74788] (3 families) (S)
  5. 2007947Family a.118.17.0: automated matches [196491] (1 protein)
    not a true family
  6. 2007948Protein automated matches [196508] (2 species)
    not a true protein
  7. 2007949Species Human (Homo sapiens) [TaxId:9606] [256186] (4 PDB entries)
  8. 2007956Domain d4jghd1: 4jgh D:10-386 [252935]
    Other proteins in same PDB: d4jgha1, d4jgha2, d4jgha3, d4jghb_, d4jghc_, d4jghd2
    automated match to d2wzka_

Details for d4jghd1

PDB Entry: 4jgh (more details), 3 Å

PDB Description: Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5
PDB Compounds: (D:) Cullin-5

SCOPe Domain Sequences for d4jghd1:

Sequence, based on SEQRES records: (download)

>d4jghd1 a.118.17.0 (D:10-386) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgslqfedkwdfmrpivlkllrqesvtkqqwfdlfsdvhavclwddkgpakihqalkedi
lefikqaqarvlshqddtallkayivewrkfftqcdilpkpfcqleitlmgkqgsnkksn
vedsivrklmldtwnesifsniknrlqdsamklvhaerlgeafdsqlvigvresyvnlcs
npedklqiyrdnfekayldsterfyrtqapsylqqngvqnymkyadaklkeeekralryl
etrrecnsvealmeccvnalvtsfketilaecqgmikrneteklhlmfslmdkvpngiep
mlkdleehiisagladmvaaaetittdsekyreqldtlfnrfsklvkeafqddprfltar
dkaykavvndatifkle

Sequence, based on observed residues (ATOM records): (download)

>d4jghd1 a.118.17.0 (D:10-386) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgslqfedkwdfmrpivlkllrqesvtkqqwfdlfsdvhavclwddkgpakihqalkedi
lefikqaqarvlshqddtallkayivewrkfftqcdilpkpfcqleitlnvedsivrklm
ldtwnesifsniknrlqdsamklvhaerlgeafdsqlvigvresyvnlcsnpedklqiyr
dnfekayldsterfyrtqapsylqqngvqnymkyadaklkeeekralryletrrecnsve
almeccvnalvtsfketilaecqgmikrneteklhlmfslmdkvpngiepmlkdleehii
sagladmvaaaetittdsekyreqldtlfnrfsklvkeafqddprfltardkaykavvnd
atifkle

SCOPe Domain Coordinates for d4jghd1:

Click to download the PDB-style file with coordinates for d4jghd1.
(The format of our PDB-style files is described here.)

Timeline for d4jghd1: