![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.271: SOCS box-like [158234] (1 superfamily) helix-loop-helix motif with orthogonally packed helices |
![]() | Superfamily a.271.1: SOCS box-like [158235] (2 families) ![]() |
![]() | Family a.271.1.0: automated matches [254330] (1 protein) not a true family |
![]() | Protein automated matches [254753] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256332] (1 PDB entry) |
![]() | Domain d4jgha2: 4jgh A:149-198 [252932] Other proteins in same PDB: d4jgha1, d4jgha3, d4jghb_, d4jghc_, d4jghd1, d4jghd2 automated match to d2c9wa1 |
PDB Entry: 4jgh (more details), 3 Å
SCOPe Domain Sequences for d4jgha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jgha2 a.271.1.0 (A:149-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} hlyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
Timeline for d4jgha2:
![]() Domains from other chains: (mouse over for more information) d4jghb_, d4jghc_, d4jghd1, d4jghd2 |