Lineage for d4jgha2 (4jgh A:149-198)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738872Fold a.271: SOCS box-like [158234] (1 superfamily)
    helix-loop-helix motif with orthogonally packed helices
  4. 2738873Superfamily a.271.1: SOCS box-like [158235] (2 families) (S)
  5. 2738887Family a.271.1.0: automated matches [254330] (1 protein)
    not a true family
  6. 2738888Protein automated matches [254753] (1 species)
    not a true protein
  7. 2738889Species Human (Homo sapiens) [TaxId:9606] [256332] (1 PDB entry)
  8. 2738890Domain d4jgha2: 4jgh A:149-198 [252932]
    Other proteins in same PDB: d4jgha1, d4jgha3, d4jghb_, d4jghc_, d4jghd1, d4jghd2
    automated match to d2c9wa1

Details for d4jgha2

PDB Entry: 4jgh (more details), 3 Å

PDB Description: Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5
PDB Compounds: (A:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d4jgha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jgha2 a.271.1.0 (A:149-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv

SCOPe Domain Coordinates for d4jgha2:

Click to download the PDB-style file with coordinates for d4jgha2.
(The format of our PDB-style files is described here.)

Timeline for d4jgha2: