Lineage for d4jgha1 (4jgh A:32-134)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530462Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2530893Protein automated matches [190202] (2 species)
    not a true protein
  7. 2530894Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)
  8. 2530915Domain d4jgha1: 4jgh A:32-134 [252931]
    Other proteins in same PDB: d4jgha2, d4jgha3, d4jghb_, d4jghc_, d4jghd1, d4jghd2
    automated match to d2c9wa2

Details for d4jgha1

PDB Entry: 4jgh (more details), 3 Å

PDB Description: Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5
PDB Compounds: (A:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d4jgha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jgha1 d.93.1.1 (A:32-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsag
ptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmck

SCOPe Domain Coordinates for d4jgha1:

Click to download the PDB-style file with coordinates for d4jgha1.
(The format of our PDB-style files is described here.)

Timeline for d4jgha1: