![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein automated matches [232759] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [256331] (1 PDB entry) |
![]() | Domain d4jghc_: 4jgh C: [252934] Other proteins in same PDB: d4jgha1, d4jgha2, d4jgha3, d4jghb_, d4jghd1, d4jghd2 automated match to d4b9kb_ |
PDB Entry: 4jgh (more details), 3 Å
SCOPe Domain Sequences for d4jghc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jghc_ d.42.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeiplellmaanfldc
Timeline for d4jghc_: