PDB entry 4jgh

View 4jgh on RCSB PDB site
Description: Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5
Class: ligase
Keywords: Cullin-RING E3 ubiquitin ligases, Ubiquitination, Cytosol, ligase
Deposited on 2013-03-01, released 2013-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: suppressor of cytokine signaling 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CIS2, Homo sapiens, SOCS2, SSI2, STATI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14508 (6-172)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d4jgha1, d4jgha2, d4jgha3
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Mus musculus [TaxId:10090]
    Gene: Mus musculus, Tceb2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jghb_
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Mus musculus [TaxId:10090]
    Gene: Mus musculus, Tceb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83940 (0-95)
      • see remark 999 (83)
    Domains in SCOPe 2.07: d4jghc_
  • Chain 'D':
    Compound: Cullin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: CUL5, Homo sapiens, VACM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93034 (0-376)
      • engineered mutation (331)
      • engineered mutation (335)
      • expression tag (377)
    Domains in SCOPe 2.07: d4jghd1, d4jghd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jghA (A:)
    hmdpefqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltis
    vktsagptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckdkrtgpeaprn
    gtvhlyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jghA (A:)
    hmdpefqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltis
    vktsagptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmckdgtvhlyltkp
    lytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jghB (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppeeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealriepfssppelpdvmkpqdsggsaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jghB (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppeeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealriepfssppelpdvmk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jghC (C:)
    myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
    ftykvrytnssteipefpiapeiplellmaanfldc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jghD (D:)
    kgslqfedkwdfmrpivlkllrqesvtkqqwfdlfsdvhavclwddkgpakihqalkedi
    lefikqaqarvlshqddtallkayivewrkfftqcdilpkpfcqleitlmgkqgsnkksn
    vedsivrklmldtwnesifsniknrlqdsamklvhaerlgeafdsqlvigvresyvnlcs
    npedklqiyrdnfekayldsterfyrtqapsylqqngvqnymkyadaklkeeekralryl
    etrrecnsvealmeccvnalvtsfketilaecqgmikrneteklhlmfslmdkvpngiep
    mlkdleehiisagladmvaaaetittdsekyreqldtlfnrfsklvkeafqddprfltar
    dkaykavvndatifklev
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jghD (D:)
    kgslqfedkwdfmrpivlkllrqesvtkqqwfdlfsdvhavclwddkgpakihqalkedi
    lefikqaqarvlshqddtallkayivewrkfftqcdilpkpfcqleitlnvedsivrklm
    ldtwnesifsniknrlqdsamklvhaerlgeafdsqlvigvresyvnlcsnpedklqiyr
    dnfekayldsterfyrtqapsylqqngvqnymkyadaklkeeekralryletrrecnsve
    almeccvnalvtsfketilaecqgmikrneteklhlmfslmdkvpngiepmlkdleehii
    sagladmvaaaetittdsekyreqldtlfnrfsklvkeafqddprfltardkaykavvnd
    atifklev