Lineage for d3rzoj_ (3rzo J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695676Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 2695677Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 2695715Protein automated matches [190336] (6 species)
    not a true protein
  7. 2695722Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256072] (1 PDB entry)
  8. 2695723Domain d3rzoj_: 3rzo J: [249252]
    Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzoe2, d3rzof_, d3rzoh_, d3rzoi1, d3rzoi2, d3rzok_, d3rzol_
    automated match to d1twfj_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3rzoj_

PDB Entry: 3rzo (more details), 3 Å

PDB Description: rna polymerase ii initiation complex with a 4-nt rna
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit RPABC5

SCOPe Domain Sequences for d3rzoj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzoj_ a.4.11.1 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d3rzoj_:

Click to download the PDB-style file with coordinates for d3rzoj_.
(The format of our PDB-style files is described here.)

Timeline for d3rzoj_: