Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) automatically mapped to Pfam PF01194 |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
Protein automated matches [190336] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256072] (1 PDB entry) |
Domain d3rzoj_: 3rzo J: [249252] Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzoe2, d3rzof_, d3rzoh_, d3rzoi1, d3rzoi2, d3rzok_, d3rzol_ automated match to d1twfj_ protein/DNA complex; protein/RNA complex; complexed with zn |
PDB Entry: 3rzo (more details), 3 Å
SCOPe Domain Sequences for d3rzoj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rzoj_ a.4.11.1 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d3rzoj_: