SCOPe 2.08: Domain d3rzoe2: 3rzo E:144-215

Lineage for d3rzoe2 (3rzo E:144-215)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families)
   automatically mapped to Pfam PF01191

5. Family d.78.1.0: automated matches [254302] (1 protein)
   not a true family

6. Protein automated matches [254702] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256076] (1 PDB entry)

8. Domain d3rzoe2: 3rzo E:144-215 [249247]
   Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzof_, d3rzoh_, d3rzoi1, d3rzoi2, d3rzoj_, d3rzok_, d3rzol_
   automated match to d1dzfa2
   protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3rzoe2

PDB Entry: 3rzo, 3 Å

PDB Description: rna polymerase ii initiation complex with a 4-nt rna

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3rzoe2:

Sequence; same for both SEQRES and ATOM records:

>d3rzoe2 d.78.1.0 (E:144-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d3rzoe2:

• d3rzoe2 first appeared in SCOPe 2.04
  
• d3rzoe2 appears in SCOPe 2.07