Lineage for d3rzoe2 (3rzo E:144-215)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958567Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2958568Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2958608Family d.78.1.0: automated matches [254302] (1 protein)
    not a true family
  6. 2958609Protein automated matches [254702] (3 species)
    not a true protein
  7. 2958614Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256076] (1 PDB entry)
  8. 2958615Domain d3rzoe2: 3rzo E:144-215 [249247]
    Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzof_, d3rzoh_, d3rzoi1, d3rzoi2, d3rzoj_, d3rzok_, d3rzol_
    automated match to d1dzfa2
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3rzoe2

PDB Entry: 3rzo (more details), 3 Å

PDB Description: rna polymerase ii initiation complex with a 4-nt rna
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3rzoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzoe2 d.78.1.0 (E:144-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d3rzoe2:

Click to download the PDB-style file with coordinates for d3rzoe2.
(The format of our PDB-style files is described here.)

Timeline for d3rzoe2: