SCOPe 2.08: Domain d3rzoi2: 3rzo I:50-120

Lineage for d3rzoi2 (3rzo I:50-120)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)

6. Protein automated matches [254700] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256069] (1 PDB entry)

8. Domain d3rzoi2: 3rzo I:50-120 [249251]
   Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzoe2, d3rzof_, d3rzoh_, d3rzoj_, d3rzok_, d3rzol_
   automated match to d1i50i2
   protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3rzoi2

PDB Entry: 3rzo, 3 Å

PDB Description: rna polymerase ii initiation complex with a 4-nt rna

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d3rzoi2:

Sequence; same for both SEQRES and ATOM records:

>d3rzoi2 g.41.3.1 (I:50-120) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

Timeline for d3rzoi2:

• d3rzoi2 first appeared in SCOPe 2.04
  
• d3rzoi2 appears in SCOPe 2.07