SCOPe 2.08: Domain d3rzoe1: 3rzo E:2-143

Lineage for d3rzoe1 (3rzo E:2-143)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)

6. Protein automated matches [254701] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256068] (1 PDB entry)

8. Domain d3rzoe1: 3rzo E:2-143 [249246]
   Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe2, d3rzof_, d3rzoh_, d3rzoi1, d3rzoi2, d3rzoj_, d3rzok_, d3rzol_
   automated match to d1dzfa1
   protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3rzoe1

PDB Entry: 3rzo, 3 Å

PDB Description: rna polymerase ii initiation complex with a 4-nt rna

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3rzoe1:

Sequence; same for both SEQRES and ATOM records:

>d3rzoe1 c.52.3.1 (E:2-143) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

Timeline for d3rzoe1:

• d3rzoe1 first appeared in SCOPe 2.04
  
• d3rzoe1 appears in SCOPe 2.07