![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) ![]() |
![]() | Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins) |
![]() | Protein automated matches [254700] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256069] (1 PDB entry) |
![]() | Domain d3rzoi1: 3rzo I:2-49 [249250] Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzoe2, d3rzof_, d3rzoh_, d3rzoj_, d3rzok_, d3rzol_ automated match to d1twfi1 protein/DNA complex; protein/RNA complex; complexed with zn |
PDB Entry: 3rzo (more details), 3 Å
SCOPe Domain Sequences for d3rzoi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rzoi1 g.41.3.1 (I:2-49) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d3rzoi1: