Lineage for d3rzof_ (3rzo F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734802Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2734842Protein automated matches [254699] (5 species)
    not a true protein
  7. 2734847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256073] (1 PDB entry)
  8. 2734848Domain d3rzof_: 3rzo F: [249248]
    Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzoe2, d3rzoh_, d3rzoi1, d3rzoi2, d3rzoj_, d3rzok_, d3rzol_
    automated match to d1twff_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3rzof_

PDB Entry: 3rzo (more details), 3 Å

PDB Description: rna polymerase ii initiation complex with a 4-nt rna
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit RPABC2

SCOPe Domain Sequences for d3rzof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzof_ a.143.1.2 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekki
plvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d3rzof_:

Click to download the PDB-style file with coordinates for d3rzof_.
(The format of our PDB-style files is described here.)

Timeline for d3rzof_: